sm3382815 sm3382815

11-10-2020
Chemistry

contestada

F. How many centigrams are in 253,000 picograms?
Plz show work

Respuesta :

ijimmyjohn ijimmyjohn

11-10-2020

The answer is 2.53e-5, I unfortunately don't know how you would really show the work other than showing the division.

Answer Link

Otras preguntas

put the steps for the deriving for the area of a triangle in the correct order

At Store #1 for $625 you can buy 25 pairs of shoes. What is the cost for 1 pair of shoes?

what is the answer? pls help i'm not sure

You are starting a new homebuilding business and are responsible for choosing a location to go to your first subdivision. Do you want to choose a place for all

Select the correct answer below Simplify

FINALLL SPANISHH QUESTIONN

The oligopeptide MNQSYGRLVSRAAIAATAMASLIKIFAWWY was cleaved by reaction with trypsin. Trypsin is a serine protease that hydrolyses peptide chains at the protein

You buy cheese in 1lb bags. Your receipt for burritos requires 0.7 ounces of cheese per serving. How many servings can you make

How many different variables are in the expression 8r-1+9r-2(q-1)+11 ? Name each variable

Explain why diversity is important for the survival of a species?