maya763527 maya763527

12-03-2021
Mathematics

contestada

Please help it’s my birthday

Please help its my birthday class=

Respuesta :

tretheman17 tretheman17

12-03-2021

Answer: I think its A im not sure tho

Step-by-step explanation:

Answer Link

Аноним Аноним

12-03-2021

Answer:

300 N right

Step-by-step explanation:

Happy Birthday!

2500-2200=300

the right side is pulling with 300N more force therefore 300N right is the correct answer

Answer Link

Otras preguntas

subcribe and i will give brainllest and thanks!!!

Biology organ system

Why do trophic Levels frompyramid shape

The oligopeptide MNQSYGRLVSRAAIAATAMASLIKIFAWWY was cleaved by reaction with trypsin. Trypsin is a serine protease that hydrolyses peptide chains at the protein

-2,-7,-12 ,.... is an arithmetic sequence Find the sum of its first 20 terms ?

RNA is chemically similar to DNA except that its sugars have an additional oxygen atom, and the base thymine is replaced by a structurally similar base called

.002 centimeters=_____ mm Help?

Why is agility important in basketball and what are some examples..

True or False: It took several years and many events before the colonists decided to fight for independence. a. TRUE b. FALSE

Briefly explain one important difference between the goals of the Spanish in the English in establishing colonies in the Americas prior to 1700