tevonburke12 tevonburke12

12-04-2021
English

contestada

When giving a survey, data:

A. will only be numbers based.

B. will primarily be qualitative.

C. can yield numbers and descriptions.

D. Can only be descriptive.

Respuesta :

edwarddayagv edwarddayagv

12-04-2021

Answer:

C. can yield numbers and descriptions

Answer Link

qve2cphxbe qve2cphxbe

12-04-2021

I’ve had this question before, it is Can yield numbers and descriptions

Answer Link

Otras preguntas

The Comanches ruled over_____

Convection occurs in the earth’s________. A. Oceans B. Mantle C. Atmosphere D. All of these.

The oligopeptide MNQSYGRLVSRAAIAATAMASLIKIFAWWY was cleaved by reaction with trypsin. Trypsin is a serine protease that hydrolyses peptide chains at the protein

What fraction is equal to 65%?

here is the question.

hcf of 72, 120, 192 with explanations

after the second continental congress appointed george washington as the commander in cheif of the continental army he

What is good side and bad side Mobilphone

Write the equation of a line that is parallel to y = 0.6x + 3 and that passes through the point (-3,-5).

List at least 5 Native Tribes and one Fact about each.