shayxmir3124 shayxmir3124
  • 12-07-2022
  • Mathematics
contestada

A student wrote the expression: 2(5x + 3) what are two expressions that are equivalent to the student's expression

Respuesta :

rdacoder
rdacoder rdacoder
  • 12-07-2022

Answer:

[tex]\frac{(20x+12)}{2}[/tex] and [tex]\sqrt{100x^2+36}[/tex]

Step-by-step explanation:

The expression 2(5x + 3) equals 10x + 6

One other way to get 10x + 6

[tex]\frac{(20x+12)}{2}[/tex]

finally, you could do:

[tex]\sqrt{100x^2+36}[/tex]

Answer Link

Otras preguntas

Plz help me quickly
what is 5+5 what is 6x5
For what were Athens and Sparta primarily known?
help me my heart is barley functioning, i fought with someone i loved and i regret it i regret it all i jus feel terrible
Please help me :>>>>
How did the Revolutionary War affect the concepts of nationalism and exceptionalism United States?
What is the slope of a line perpendicular to Line AB given A (6,2) and B (-3,2)
7. The price of a taxi ride starts at $3.00 and costs $0.20 per mile after that. How much would a 25-mile ride cost?
Item 12 SA−→ bisects ∠RST and m∠RST=54.2∘. Find m∠RSA and m∠AST.
The oligopeptide MNQSYGRLVSRAAIAATAMASLIKIFAWWY was cleaved by reaction with trypsin. Trypsin is a serine protease that hydrolyses peptide chains at the protein