mike132 mike132
  • 10-02-2016
  • History
contestada

What role did nationalism play in the political system called faciam ?

Respuesta :

Аноним Аноним
  • 10-02-2016
faciam means "I shall either find a way or make one." and nationalism means "The strong belief that the interests of a particular nation-state are of primary importance" i think is pretty clear what happened there
Answer Link

Otras preguntas

Evaluate f(1/2) if f(x)=-3x^3 + 2x^2. Enter fractions using “/“ f(1/2)=
a photo collage consists of seven equal sized square photo arranged in a row to form a rectangle if the total area of the college is 567 square inches what is t
Why is one side of the moon called "the dark side of the moon ? OA. The amount of time it takes to rotate around its axis is the same amount of time it takes to
plz halp muh im SUPER tired and cant do this myself
Compare and contrast the two types of tsunami
A car is traveling at a speed of 45 km/h into town. It takes the car 2 hours to get there. How far has the car traveled?
According to the author how do words get their meaning? gloria naylor
The oligopeptide MNQSYGRLVSRAAIAATAMASLIKIFAWWY was cleaved by reaction with trypsin. Trypsin is a serine protease that hydrolyses peptide chains at the protein
what are "" called like for example: sam said "I will go to the park at 4:00 and come back at 6"
The code of hammurabis = who was involved